CK1 epsilon antibody (N-Term)

Catalog No. ABIN630641

The Rabbit Polyclonal anti-CK1 epsilon antibody has been validated for WB. It is suitable to detect CK1 epsilon in samples from Human, Mouse, Rat and Drosophila melanogaster.

Quick Overview for CK1 epsilon antibody (N-Term) (ABIN630641)

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CK1 epsilon antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CK1 epsilon Antibody

Binding Specificity: N-Term

Specificity: CK1 epsilon antibody was raised against the N terminal of CSNK1 E

Purification: Affinity purified

Immunogen: CK1 epsilon antibody was raised using the N terminal of CSNK1 E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK1 epsilon Blocking Peptide, (ABIN5612898), is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CK1 epsilon

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Alternative Name: CK1 epsilon

Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Hedgehog Signaling, M Phase