TSSK2 antibody (Middle Region)

Catalog No. ABIN630656

The Rabbit Polyclonal anti-TSSK2 antibody is suitable to detect TSSK2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for TSSK2 antibody (Middle Region) (ABIN630656)

Target: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSSK2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSSK2 Antibody

Binding Specificity: Middle Region

Specificity: TSSK2 antibody was raised against the middle region of TSSK2

Purification: Affinity purified

Immunogen: TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSSK2 Blocking Peptide, (ABIN5616832), is also available for use as a blocking control in assays to test for specificity of this TSSK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSSK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSSK2

Target: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Alternative Name: TSSK2

Background: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.

Molecular Weight: 39 kDa (MW of target protein)