CK1 delta (Middle Region) antibody

Catalog No. ABIN630662

The Rabbit Polyclonal anti- antibody has been validated for WB. It is suitable to detect in samples from Human, Mouse and Rat.

Quick Overview for CK1 delta (Middle Region) antibody (ABIN630662)

Target: CK1 delta

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: CK1 delta antibody was raised against the middle region of CSNK1 D

Purification: Affinity purified

Immunogen: CK1 delta antibody was raised using the middle region of CSNK1 D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK1 delta Blocking Peptide, (ABIN5612897), is also available for use as a blocking control in assays to test for specificity of this CK1 delta antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: CK1 delta

Background: This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair.

Molecular Weight: 47 kDa (MW of target protein)