LOC642097 antibody (N-Term)

Catalog No. ABIN630692

The Rabbit Polyclonal anti-LOC642097 antibody has been validated for WB. It is suitable to detect LOC642097 in samples from Human.

Quick Overview for LOC642097 antibody (N-Term) (ABIN630692)

Target: LOC642097

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-LOC642097 Antibody

Binding Specificity: N-Term

Specificity: LOC642097 antibody was raised against the N terminal Of Loc642097

Purification: Affinity purified

Immunogen: LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC642097 Blocking Peptide, (ABIN5614524), is also available for use as a blocking control in assays to test for specificity of this LOC642097 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC642097 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOC642097

Target: LOC642097

Alternative Name: LOC642097

Background: The function of LOC642097 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 37 kDa (MW of target protein)