PARP3 antibody
-
- Target See all PARP3 Antibodies
- PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PARP3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP
- Top Product
- Discover our top product PARP3 Primary Antibody
-
-
- Application Notes
-
WB: 1-2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PARP3 Blocking Peptide, catalog no. 33R-4994, is also available for use as a blocking control in assays to test for specificity of this PARP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))
- Alternative Name
- PARP3 (PARP3 Products)
- Synonyms
- ADPRT-3 antibody, PARP-3 antibody, PM38 antibody, Adprtl3 antibody, fj17c06 antibody, wu:fj17c06 antibody, zgc:66157 antibody, PARP3 antibody, parp3 antibody, ADPRT3 antibody, ADPRTL2 antibody, ADPRTL3 antibody, ARTD3 antibody, IRT1 antibody, PADPRT-3 antibody, A930002C11Rik antibody, AW990611 antibody, Adprt3 antibody, pADPRT-3 antibody, seed maturation protein PM38 antibody, poly (ADP-ribose) polymerase family, member 3 antibody, poly(ADP-ribose) polymerase family member 3 antibody, poly(ADP-ribose) polymerase family member 3 L homeolog antibody, PARP3 antibody, parp3 antibody, parp3.L antibody, Parp3 antibody
- Background
- PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molecular Weight
- 59 kDa (MW of target protein)
-