PARP3 antibody

Catalog No. ABIN630693

Product Details anti-PARP3 Antibody

Target: PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP

Application Details

Application Notes: WB: 1-2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP3 Blocking Peptide, catalog no. 33R-4994, is also available for use as a blocking control in assays to test for specificity of this PARP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP3

Target: PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))

Alternative Name: PARP3 (PARP3 Products)

Synonyms: ADPRT-3 antibody, PARP-3 antibody, PM38 antibody, Adprtl3 antibody, fj17c06 antibody, wu:fj17c06 antibody, zgc:66157 antibody, PARP3 antibody, parp3 antibody, ADPRT3 antibody, ADPRTL2 antibody, ADPRTL3 antibody, ARTD3 antibody, IRT1 antibody, PADPRT-3 antibody, A930002C11Rik antibody, AW990611 antibody, Adprt3 antibody, pADPRT-3 antibody, seed maturation protein PM38 antibody, poly (ADP-ribose) polymerase family, member 3 antibody, poly(ADP-ribose) polymerase family member 3 antibody, poly(ADP-ribose) polymerase family member 3 L homeolog antibody, PARP3 antibody, parp3 antibody, parp3.L antibody, Parp3 antibody

Background: PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 59 kDa (MW of target protein)