RORC antibody (N-Term)

Catalog No. ABIN630715

This Rabbit Polyclonal antibody specifically detects RORC in WB. It exhibits reactivity toward Human.

Quick Overview for RORC antibody (N-Term) (ABIN630715)

Target: RORC (RAR-Related Orphan Receptor C (RORC))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RORC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RORC Antibody

Binding Specificity: N-Term

Specificity: RORC antibody was raised against the N terminal of RORC

Purification: Affinity purified

Immunogen: RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RORC Blocking Peptide, (ABIN938041), is also available for use as a blocking control in assays to test for specificity of this RORC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RORC

Target: RORC (RAR-Related Orphan Receptor C (RORC))

Alternative Name: RORC

Background: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known, however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway