PINX1 antibody (N-Term)

Catalog No. ABIN630717

This anti-PINX1 antibody is a Rabbit Polyclonal antibody detecting PINX1 in WB. Suitable for Human.

Quick Overview for PINX1 antibody (N-Term) (ABIN630717)

Target: PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PINX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PINX1 Antibody

Binding Specificity: N-Term

Specificity: PINX1 antibody was raised against the N terminal of PINX1

Purification: Affinity purified

Immunogen: PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PINX1 Blocking Peptide, (ABIN937902), is also available for use as a blocking control in assays to test for specificity of this PINX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PINX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PINX1

Target: PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))

Alternative Name: PINX1

Background: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres.

Molecular Weight: 37 kDa (MW of target protein)