PINX1 antibody (N-Term)
-
- Target See all PINX1 Antibodies
- PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PINX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PINX1 antibody was raised against the N terminal of PINX1
- Purification
- Affinity purified
- Immunogen
- PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF
- Top Product
- Discover our top product PINX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PINX1 Blocking Peptide, catalog no. 33R-2516, is also available for use as a blocking control in assays to test for specificity of this PINX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PINX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))
- Alternative Name
- PINX1 (PINX1 Products)
- Synonyms
- PINX1 antibody, LPTL antibody, LPTS antibody, 2210403I16Rik antibody, 2610028A01Rik antibody, 67-11-3 antibody, AU024023 antibody, LPTS1 antibody, RGD1566025 antibody, PIN2/TERF1 interacting telomerase inhibitor 1 antibody, PIN2/TERF1 interacting, telomerase inhibitor 1 antibody, PINX1 antibody, Pinx1 antibody
- Background
- PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres.
- Molecular Weight
- 37 kDa (MW of target protein)
-