PARP6 antibody

Catalog No. ABIN630726

This anti-PARP6 antibody is a Rabbit Polyclonal antibody detecting PARP6 in WB and IHC. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for PARP6 antibody (ABIN630726)

Target: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PARP6 Antibody

Purification: Affinity purified

Immunogen: PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP6 Blocking Peptide, (ABIN939914), is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP6

Target: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Alternative Name: PARP6

Background: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

Molecular Weight: 59 kDa (MW of target protein)