CENPA antibody (Middle Region)

Catalog No. ABIN630727

This Rabbit Polyclonal antibody specifically detects CENPA in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for CENPA antibody (Middle Region) (ABIN630727)

Target: CENPA (Centromere Protein A (CENPA))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CENPA Antibody

Binding Specificity: Middle Region

Specificity: CENPA antibody was raised against the middle region of CENPA

Purification: Affinity purified

Immunogen: CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPA Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CENPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPA

Target: CENPA (Centromere Protein A (CENPA))

Alternative Name: CENPA

Background: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Chromatin Binding, Maintenance of Protein Location