QTRT1 antibody
-
- Target See all QTRT1 Antibodies
- QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This QTRT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
- Top Product
- Discover our top product QTRT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
QTRT1 Blocking Peptide, catalog no. 33R-4290, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))
- Alternative Name
- QTRT1 (QTRT1 Products)
- Background
- TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-