ALG1L3P antibody (C-Term)

Catalog No. ABIN630743

The Rabbit Polyclonal anti-ALG1L3P antibody has been validated for WB. It is suitable to detect ALG1L3P in samples from Human.

Quick Overview for ALG1L3P antibody (C-Term) (ABIN630743)

Target: ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG1L3P antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALG1L3P Antibody

Binding Specificity: C-Term

Specificity: LOC650515 antibody was raised against the C terminal of LOC650515

Purification: Affinity purified

Immunogen: LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC650515 Blocking Peptide, (ABIN5614529), is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC650515 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG1L3P

Target: ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))

Background: The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.

Molecular Weight: 39 kDa (MW of target protein)