NUP35 antibody (C-Term)
-
- Target See all NUP35 Antibodies
- NUP35 (Nucleoporin 35kDa (NUP35))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUP35 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NUP35 antibody was raised against the C terminal of NUP35
- Purification
- Affinity purified
- Immunogen
- NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW
- Top Product
- Discover our top product NUP35 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUP35 Blocking Peptide, catalog no. 33R-8881, is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP35 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUP35 (Nucleoporin 35kDa (NUP35))
- Alternative Name
- NUP35 (NUP35 Products)
- Background
- NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.
- Molecular Weight
- 35 kDa (MW of target protein)
-