RPL30 antibody (Middle Region)

Catalog No. ABIN630753

This anti-RPL30 antibody is a Rabbit Polyclonal antibody detecting RPL30 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RPL30 antibody (Middle Region) (ABIN630753)

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL30 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL30 Antibody

Binding Specificity: Middle Region

Specificity: RPL30 antibody was raised against the middle region of RPL30

Purification: Affinity purified

Immunogen: RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL30 Blocking Peptide, (ABIN5615939), is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL30

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Alternative Name: RPL30

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

Molecular Weight: 13 kDa (MW of target protein)