HCFC1R1 antibody
-
- Target See all HCFC1R1 Antibodies
- HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HCFC1R1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HCFC1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM
- Top Product
- Discover our top product HCFC1R1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HCFC1R1 Blocking Peptide, catalog no. 33R-5357, is also available for use as a blocking control in assays to test for specificity of this HCFC1R1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCFC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))
- Alternative Name
- HCFC1R1 (HCFC1R1 Products)
- Background
- HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.
- Molecular Weight
- 15 kDa (MW of target protein)
-