HCFC1R1 antibody

Catalog No. ABIN630754

This Rabbit Polyclonal antibody specifically detects HCFC1R1 in WB. It exhibits reactivity toward Human.

Quick Overview for HCFC1R1 antibody (ABIN630754)

Target: HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HCFC1R1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HCFC1R1 Antibody

Purification: Affinity purified

Immunogen: HCFC1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HCFC1R1 Blocking Peptide, (ABIN5613945), is also available for use as a blocking control in assays to test for specificity of this HCFC1R1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCFC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HCFC1R1

Target: HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))

Alternative Name: HCFC1R1

Background: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Molecular Weight: 15 kDa (MW of target protein)