RAP1GAP antibody (Middle Region)

Catalog No. ABIN630756

Product Details anti-RAP1GAP Antibody

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAP1GAP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAP1 GAP antibody was raised against the middle region of RAP1 AP

Purification: Affinity purified

Immunogen: RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAP1GAP Blocking Peptide, catalog no. 33R-3948, is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAP1GAP

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Alternative Name: RAP1GAP (RAP1GAP Products)

Synonyms: RAP1GA1 antibody, RAP1GAP1 antibody, RAP1GAPII antibody, RAPGAP antibody, 1300019I11Rik antibody, 2310004O14Rik antibody, AI427470 antibody, Rap1ga1 antibody, RAP1 antibody, RAP1GAP antibody, rap1ga1 antibody, rap1gap1 antibody, rap1gapii antibody, rapgap antibody, zgc:175180 antibody, DKFZp459A114 antibody, RAP1 GTPase activating protein antibody, Rap1 GTPase-activating protein antibody, RAP1 GTPase activating protein 1 antibody, RAP1 GTPase activating protein L homeolog antibody, Rap1 GTPase-activating protein 1 antibody, si:dkey-166d12.2 antibody, RAP1GAP antibody, Rap1gap antibody, RAP1GAP1 antibody, rap1gap.L antibody, Tsp_09520 antibody, rap1gap antibody, si:dkey-166d12.2 antibody

Background: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Molecular Weight: 73 kDa (MW of target protein)