RAP1GAP antibody (Middle Region)
-
- Target See all RAP1GAP Antibodies
- RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAP1GAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAP1 GAP antibody was raised against the middle region of RAP1 AP
- Purification
- Affinity purified
- Immunogen
- RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
- Top Product
- Discover our top product RAP1GAP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAP1GAP Blocking Peptide, catalog no. 33R-3948, is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))
- Alternative Name
- RAP1GAP (RAP1GAP Products)
- Synonyms
- RAP1GA1 antibody, RAP1GAP1 antibody, RAP1GAPII antibody, RAPGAP antibody, 1300019I11Rik antibody, 2310004O14Rik antibody, AI427470 antibody, Rap1ga1 antibody, RAP1 antibody, RAP1GAP antibody, rap1ga1 antibody, rap1gap1 antibody, rap1gapii antibody, rapgap antibody, zgc:175180 antibody, DKFZp459A114 antibody, RAP1 GTPase activating protein antibody, Rap1 GTPase-activating protein antibody, RAP1 GTPase activating protein 1 antibody, RAP1 GTPase activating protein L homeolog antibody, Rap1 GTPase-activating protein 1 antibody, si:dkey-166d12.2 antibody, RAP1GAP antibody, Rap1gap antibody, RAP1GAP1 antibody, rap1gap.L antibody, Tsp_09520 antibody, rap1gap antibody, si:dkey-166d12.2 antibody
- Background
- RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.
- Molecular Weight
- 73 kDa (MW of target protein)
-