RAP1GAP antibody (Middle Region)

Catalog No. ABIN630756

The Rabbit Polyclonal anti-RAP1GAP antibody (ABIN630756) specifically detects RAP1GAP in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for RAP1GAP antibody (Middle Region) (ABIN630756)

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAP1GAP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAP1GAP Antibody

Binding Specificity: Middle Region

Specificity: RAP1 GAP antibody was raised against the middle region of RAP1 AP

Purification: Affinity purified

Immunogen: RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAP1GAP Blocking Peptide, (ABIN939334), is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAP1GAP

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Alternative Name: RAP1GAP

Background: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Molecular Weight: 73 kDa (MW of target protein)