HOXA7 antibody (C-Term)

Catalog No. ABIN630763

This Rabbit Polyclonal antibody specifically detects HOXA7 in WB. It exhibits reactivity toward Drosophila melanogaster.

Quick Overview for HOXA7 antibody (C-Term) (ABIN630763)

Target: HOXA7 (Homeobox A7 (HOXA7))

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HOXA7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HOXA7 Antibody

Binding Specificity: C-Term

Specificity: ANTP antibody was raised against the C terminal Of Antp

Purification: Affinity purified

Immunogen: ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANTP Blocking Peptide, (ABIN5612092), is also available for use as a blocking control in assays to test for specificity of this ANTP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HOXA7

Target: HOXA7 (Homeobox A7 (HOXA7))

Alternative Name: ANTP

Background: Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.

Molecular Weight: 33 kDa (MW of target protein)