LIN7C antibody

Catalog No. ABIN630769

This Rabbit Polyclonal antibody specifically detects LIN7C in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for LIN7C antibody (ABIN630769)

Target: LIN7C (Lin-7 Homolog C (LIN7C))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIN7C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIN7C Antibody

Purification: Affinity purified

Immunogen: LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIN7C Blocking Peptide, (ABIN5614458), is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIN7C

Target: LIN7C (Lin-7 Homolog C (LIN7C))

Alternative Name: LIN7C

Background: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Synaptic Membrane