GABARAP antibody

Catalog No. ABIN630786

The Rabbit Polyclonal anti-GABARAP antibody (ABIN630786) specifically detects GABARAP in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for GABARAP antibody (ABIN630786)

Target: GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABARAP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GABARAP Antibody

Purification: Affinity purified

Immunogen: GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABARAP Blocking Peptide, (ABIN939768), is also available for use as a blocking control in assays to test for specificity of this GABARAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABARAP

Target: GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))

Alternative Name: GABARAP

Background: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Autophagy