CCDC50 antibody (Middle Region)

Catalog No. ABIN630791

Product Details anti-CCDC50 Antibody

Target: CCDC50 (Coiled-Coil Domain Containing 50 (CCDC50))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC50 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC50 antibody was raised against the middle region of CCDC50

Purification: Affinity purified

Immunogen: CCDC50 antibody was raised using the middle region of CCDC50 corresponding to a region with amino acids GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC50 Blocking Peptide, catalog no. 33R-3435, is also available for use as a blocking control in assays to test for specificity of this CCDC50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC50

Target: CCDC50 (Coiled-Coil Domain Containing 50 (CCDC50))

Alternative Name: CCDC50 (CCDC50 Products)

Synonyms: ymer antibody, C3orf6 antibody, DFNA44 antibody, YMER antibody, 2610529H08Rik antibody, 5730448P06Rik antibody, AW048328 antibody, AW546090 antibody, D16Bwg1543e antibody, C3orf6h antibody, c3orf6 antibody, coiled-coil domain containing 50 antibody, coiled-coil domain containing 50 L homeolog antibody, CCDC50 antibody, ccdc50.L antibody, ccdc50 antibody, Ccdc50 antibody

Background: CCDC50 is a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling.

Molecular Weight: 56 kDa (MW of target protein)