LCP1 antibody
-
- Target See all LCP1 Antibodies
- LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LCP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK
- Top Product
- Discover our top product LCP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LCP1 Blocking Peptide, catalog no. 33R-2929, is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))
- Alternative Name
- LCP1 (LCP1 Products)
- Synonyms
- CP64 antibody, L-PLASTIN antibody, LC64P antibody, LPL antibody, PLS2 antibody, cb245 antibody, fj24b12 antibody, wu:fj24b12 antibody, cp64 antibody, l-plastin antibody, lc64p antibody, lpl antibody, pls2 antibody, plastin-2 antibody, AW536232 antibody, D14Ertd310e antibody, LCP-1 antibody, Pls2 antibody, pp65 antibody, lymphocyte cytosolic protein 1 antibody, lymphocyte cytosolic protein 1 (L-plastin) antibody, lymphocyte cytosolic protein 1 (L-plastin) S homeolog antibody, lower matrix protein; involved in immune regulation antibody, LCP1 antibody, lcp1 antibody, lcp1.S antibody, Lcp1 antibody, UL83 antibody
- Background
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
- Molecular Weight
- 70 kDa (MW of target protein)
-