TRIM45 antibody (N-Term)

Catalog No. ABIN630795

This anti-TRIM45 antibody is a Rabbit Polyclonal antibody detecting TRIM45 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TRIM45 antibody (N-Term) (ABIN630795)

Target: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM45 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRIM45 Antibody

Binding Specificity: N-Term

Specificity: TRIM45 antibody was raised against the N terminal of TRIM45

Purification: Affinity purified

Immunogen: TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM45 Blocking Peptide, (ABIN938327), is also available for use as a blocking control in assays to test for specificity of this TRIM45 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM45

Target: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Alternative Name: TRIM45

Background: TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.

Molecular Weight: 64 kDa (MW of target protein)