NARG1L antibody (Middle Region)

Catalog No. ABIN630806

The Rabbit Polyclonal anti-NARG1L antibody is suitable to detect NARG1L in samples from Human, Mouse and Rat. It has been validated for WB and IHC.

Quick Overview for NARG1L antibody (Middle Region) (ABIN630806)

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NARG1L antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-NARG1L Antibody

Binding Specificity: Middle Region

Specificity: NARG1 L antibody was raised against the middle region of NARG1

Purification: Affinity purified

Immunogen: NARG1 L antibody was raised using the middle region of NARG1 corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NARG1L Blocking Peptide, (ABIN936902), is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NARG1L

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Alternative Name: NARG1L

Background: NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Molecular Weight: 50 kDa (MW of target protein)