DAAM1 antibody (Middle Region)
-
- Target See all DAAM1 Antibodies
- DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DAAM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DAAM1 antibody was raised against the middle region of DAAM1
- Purification
- Affinity purified
- Immunogen
- DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV
- Top Product
- Discover our top product DAAM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DAAM1 Blocking Peptide, catalog no. 33R-3460, is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAAM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))
- Alternative Name
- DAAM1 (DAAM1 Products)
- Background
- The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.
- Molecular Weight
- 123 kDa (MW of target protein)
- Pathways
- WNT Signaling
-