DAAM1 antibody (Middle Region)

Catalog No. ABIN630809

Product Details anti-DAAM1 Antibody

Target: DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAAM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DAAM1 antibody was raised against the middle region of DAAM1

Purification: Affinity purified

Immunogen: DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAAM1 Blocking Peptide, catalog no. 33R-3460, is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAAM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAAM1

Target: DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))

Alternative Name: DAAM1 (DAAM1 Products)

Background: The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.

Molecular Weight: 123 kDa (MW of target protein)

Pathways: WNT Signaling