GTPBP4 antibody (C-Term)

Catalog No. ABIN630811

This Rabbit Polyclonal antibody specifically detects GTPBP4 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for GTPBP4 antibody (C-Term) (ABIN630811)

Target: GTPBP4 (GTP Binding Protein 4 (GTPBP4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTPBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GTPBP4 Antibody

Binding Specificity: C-Term

Specificity: GTPBP4 antibody was raised against the C terminal of GTPBP4

Purification: Affinity purified

Immunogen: GTPBP4 antibody was raised using the C terminal of GTPBP4 corresponding to a region with amino acids MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP4 Blocking Peptide, (ABIN5613904), is also available for use as a blocking control in assays to test for specificity of this GTPBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTPBP4

Target: GTPBP4 (GTP Binding Protein 4 (GTPBP4))

Alternative Name: GTPBP4

Background: GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.

Molecular Weight: 74 kDa (MW of target protein)