LGALS8 antibody
-
- Target See all LGALS8 Antibodies
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LGALS8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
- Top Product
- Discover our top product LGALS8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LGALS8 Blocking Peptide, catalog no. 33R-3014, is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
- Alternative Name
- LGALS8 (LGALS8 Products)
- Background
- LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.
- Molecular Weight
- 39 kDa (MW of target protein)
-