Myoglobin antibody (N-Term)

Catalog No. ABIN630815

The Rabbit Polyclonal anti-Myoglobin antibody has been validated for WB. It is suitable to detect Myoglobin in samples from Human. There is 1 publication available.

Quick Overview for Myoglobin antibody (N-Term) (ABIN630815)

Target: Myoglobin (MB)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myoglobin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Myoglobin Antibody

Binding Specificity: N-Term

Specificity: Myoglobin antibody was raised against the N terminal of MB

Purification: Affinity purified

Immunogen: Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myoglobin Blocking Peptide, (ABIN5614898), is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS

Concentration: Lot specific

Buffer: PBS, 0.09% sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Myoglobin antibody (ABIN630815)

Bell, Wilding, Funke, Perumal, Beck, Wolters, Holz-Müller, Pfeiffer, Grus: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).

Target Details for Myoglobin

Target: Myoglobin (MB)

Alternative Name: Myoglobin

Background: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation