FBXO24 antibody (Middle Region)

Catalog No. ABIN630822

This anti-FBXO24 antibody is a Rabbit Polyclonal antibody detecting FBXO24 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for FBXO24 antibody (Middle Region) (ABIN630822)

Target: FBXO24 (F-Box Protein 24 (FBXO24))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO24 Antibody

Binding Specificity: Middle Region

Specificity: FBXO24 antibody was raised against the middle region of FBXO24

Purification: Affinity purified

Immunogen: FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO24 Blocking Peptide, (ABIN937822), is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO24

Target: FBXO24 (F-Box Protein 24 (FBXO24))

Alternative Name: FBXO24

Background: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Molecular Weight: 36 kDa (MW of target protein)