MATN2 antibody (Middle Region)

Catalog No. ABIN630823

This Rabbit Polyclonal antibody specifically detects MATN2 in WB. It exhibits reactivity toward Human.

Quick Overview for MATN2 antibody (Middle Region) (ABIN630823)

Target: MATN2 (Matrilin 2 (MATN2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MATN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MATN2 Antibody

Binding Specificity: Middle Region

Specificity: Matrilin 2 antibody was raised against the middle region of MATN2

Purification: Affinity purified

Immunogen: Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Matrilin 2 Blocking Peptide, (ABIN936984), is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MATN2

Target: MATN2 (Matrilin 2 (MATN2))

Alternative Name: Matrilin 2

Background: MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.

Molecular Weight: 102 kDa (MW of target protein)