LIAS antibody (C-Term)

Catalog No. ABIN630828

The Rabbit Polyclonal anti-LIAS antibody (ABIN630828) specifically detects LIAS in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for LIAS antibody (C-Term) (ABIN630828)

Target: LIAS (Lipoic Acid Synthetase (LIAS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIAS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIAS Antibody

Binding Specificity: C-Term

Specificity: LIAS antibody was raised against the C terminal of LIAS

Purification: Affinity purified

Immunogen: LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIAS Blocking Peptide, (ABIN938208), is also available for use as a blocking control in assays to test for specificity of this LIAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIAS

Target: LIAS (Lipoic Acid Synthetase (LIAS))

Alternative Name: LIAS

Background: LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Tube Formation