CNN2 antibody (N-Term)

Catalog No. ABIN630847

This Rabbit Polyclonal antibody specifically detects CNN2 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for CNN2 antibody (N-Term) (ABIN630847)

Target: CNN2 (Calponin 2 (CNN2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CNN2 Antibody

Binding Specificity: N-Term

Specificity: Calponin 2 antibody was raised against the N terminal of CNN2

Purification: Affinity purified

Immunogen: Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calponin 2 Blocking Peptide, (ABIN936067), is also available for use as a blocking control in assays to test for specificity of this Calponin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNN2

Target: CNN2 (Calponin 2 (CNN2))

Alternative Name: Calponin 2

Background: CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.

Molecular Weight: 34 kDa (MW of target protein)