GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) antibody

Catalog No. ABIN630853

This Rabbit Polyclonal antibody specifically detects GC-Rich Promoter Binding Protein 1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) antibody (ABIN630853)

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details

Binding Specificity: N-Term

Specificity: DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169

Purification: Affinity purified

Immunogen: DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DKFZP761C169 Blocking Peptide, (ABIN5613207), is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Background: Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Molecular Weight: 52 kDa (MW of target protein)