HSPA4 antibody (Middle Region)
-
- Target See all HSPA4 Antibodies
- HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSPA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HSPA4 antibody was raised against the middle region of HSPA4
- Purification
- Affinity purified
- Immunogen
- HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
- Top Product
- Discover our top product HSPA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSPA4 Blocking Peptide, catalog no. 33R-7155, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))
- Alternative Name
- HSPA4 (HSPA4 Products)
- Synonyms
- APG-2 antibody, HS24/P52 antibody, HSPH2 antibody, RY antibody, hsp70 antibody, hsp70RY antibody, Hsp110 antibody, Hsp70 antibody, irp94 antibody, 70kDa antibody, AI317151 antibody, Hsp70RY antibody, mKIAA4025 antibody, hspa4 antibody, wu:fi30e11 antibody, zgc:55743 antibody, zgc:77413 antibody, hs24/p52 antibody, hspa4-a antibody, osp94 antibody, pg-2 antibody, hspa4l antibody, wu:fc41d05 antibody, wu:fi59h02 antibody, wu:fj35c08 antibody, zgc:55506 antibody, heat shock protein family A (Hsp70) member 4 antibody, heat shock protein family A member 4 antibody, heat shock protein 4 antibody, heat shock protein 4b antibody, heat shock protein family A (Hsp70) member 4 S homeolog antibody, heat shock protein 4a antibody, HSPA4 antibody, Hspa4 antibody, hspa4b antibody, hspa4.S antibody, hspa4a antibody
- Background
- HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.
- Molecular Weight
- 94 kDa (MW of target protein)
-