PDE4B antibody

Catalog No. ABIN630858

Product Details anti-PDE4B Antibody

Target: PDE4B (phosphodiesterase 4B, cAMP-Specific (PDE4B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE4B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PDE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE4B Blocking Peptide, catalog no. 33R-7502, is also available for use as a blocking control in assays to test for specificity of this PDE4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE4B

Target: PDE4B (phosphodiesterase 4B, cAMP-Specific (PDE4B))

Alternative Name: PDE4B (PDE4B Products)

Synonyms: dpde4 antibody, pde4b5 antibody, pdeivb antibody, Dpde4 antibody, R74983 antibody, dunce antibody, PDE4/IVb antibody, Pde4B1 antibody, Pde4B2 antibody, Pde4B3 antibody, Pde4B4 antibody, DPDE4 antibody, PDE4B5 antibody, PDEIVB antibody, phosphodiesterase 4B antibody, phosphodiesterase 4B, cAMP specific antibody, phosphodiesterase 4B S homeolog antibody, pde4b antibody, PDE4B antibody, Pde4b antibody, pde4b.S antibody

Background: This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, cAMP Metabolic Process, Myometrial Relaxation and Contraction