FKBP3 antibody (C-Term)

Catalog No. ABIN630860

The Rabbit Polyclonal anti-FKBP3 antibody has been validated for WB. It is suitable to detect FKBP3 in samples from Human, Mouse and Rat.

Quick Overview for FKBP3 antibody (C-Term) (ABIN630860)

Target: FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FKBP3 Antibody

Binding Specificity: C-Term

Specificity: FKBP3 antibody was raised against the C terminal of FKBP3

Purification: Affinity purified

Immunogen: FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP3 Blocking Peptide, (ABIN937652), is also available for use as a blocking control in assays to test for specificity of this FKBP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP3

Target: FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))

Alternative Name: FKBP3

Background: FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Molecular Weight: 25 kDa (MW of target protein)