PPAT antibody (C-Term)

Catalog No. ABIN630866

The Rabbit Polyclonal anti-PPAT antibody has been validated for WB. It is suitable to detect PPAT in samples from Human.

Quick Overview for PPAT antibody (C-Term) (ABIN630866)

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPAT Antibody

Binding Specificity: C-Term

Specificity: PPAT antibody was raised against the C terminal of PPAT

Purification: Affinity purified

Immunogen: PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPAT Blocking Peptide, (ABIN5615488), is also available for use as a blocking control in assays to test for specificity of this PPAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPAT

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Alternative Name: PPAT

Background: PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Molecular Weight: 56 kDa (MW of target protein)