NARF antibody (Middle Region)

Catalog No. ABIN630867

The Rabbit Polyclonal anti-NARF antibody (ABIN630867) specifically detects NARF in WB. The antibody is reactive with Human samples.

Quick Overview for NARF antibody (Middle Region) (ABIN630867)

Target: NARF (Nuclear Prelamin A Recognition Factor (NARF))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NARF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NARF Antibody

Binding Specificity: Middle Region

Specificity: NARF antibody was raised against the middle region of NARF

Purification: Affinity purified

Immunogen: NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NARF Blocking Peptide, (ABIN938440), is also available for use as a blocking control in assays to test for specificity of this NARF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NARF

Target: NARF (Nuclear Prelamin A Recognition Factor (NARF))

Alternative Name: NARF

Background: NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.

Molecular Weight: 55 kDa (MW of target protein)