Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GAPDH antibody (Middle Region)

There are 3+ publications for this product available. The Rabbit Polyclonal anti-GAPDH antibody has been validated for WB. It is suitable to detect GAPDH in samples from Human and Mouse.
Catalog No. ABIN630875
-15% Promotion 2026
$1,433.54
$1,686.52
save $252.98 (-15 %)
Plus shipping costs $50.00
100 μL
Shipping to: United States
Delivery in 9 to 11 Business Days

Quick Overview for GAPDH antibody (Middle Region) (ABIN630875)

Target

See all GAPDH Antibodies
GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Reactivity

  • 249
  • 170
  • 150
  • 65
  • 58
  • 46
  • 45
  • 34
  • 30
  • 28
  • 25
  • 22
  • 19
  • 15
  • 15
  • 14
  • 12
  • 9
  • 9
  • 6
  • 4
  • 4
  • 4
  • 4
  • 4
  • 4
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Mouse

Host

  • 191
  • 93
  • 16
  • 9
  • 4
Rabbit

Clonality

  • 187
  • 124
Polyclonal

Conjugate

  • 173
  • 32
  • 20
  • 16
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
This GAPDH antibody is un-conjugated

Application

  • 257
  • 103
  • 95
  • 95
  • 55
  • 55
  • 50
  • 36
  • 16
  • 16
  • 15
  • 15
  • 7
  • 6
  • 5
  • 4
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Binding Specificity

    • 34
    • 24
    • 13
    • 12
    • 8
    • 7
    • 6
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region

    Specificity

    GAPDH antibody was raised against the middle region of GAPDH

    Purification

    Affinity purified

    Immunogen

    GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
  • Application Notes

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Comment

    GAPDH Blocking Peptide, (ABIN939625), is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

    Restrictions

    For Research Use only
  • Format

    Lyophilized

    Reconstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS

    Concentration

    Lot specific

    Buffer

    PBS

    Handling Advice

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Storage

    4 °C/-20 °C

    Storage Comment

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

    Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

    Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." in: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

  • Target

    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

    Alternative Name

    GAPDH

    Background

    GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

    Molecular Weight

    36 kDa (MW of target protein)
You are here:
Chat with us!