GLE1 antibody

Catalog No. ABIN630876

This anti-GLE1 antibody is a Rabbit Polyclonal antibody detecting GLE1 in WB. Suitable for Human.

Quick Overview for GLE1 antibody (ABIN630876)

Target: GLE1 (GLE1 RNA Export Mediator (GLE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GLE1 Antibody

Purification: Affinity purified

Immunogen: GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLE1 Blocking Peptide, (ABIN940475), is also available for use as a blocking control in assays to test for specificity of this GLE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLE1

Target: GLE1 (GLE1 RNA Export Mediator (GLE1))

Alternative Name: GLE1

Background: GLE1 is a predicted 75 kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes.

Molecular Weight: 75 kDa (MW of target protein)