MEMO1 antibody (Middle Region)

Catalog No. ABIN630881

Product Details anti-MEMO1 Antibody

Target: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MEMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MEMO1 antibody was raised against the middle region of MEMO1

Purification: Affinity purified

Immunogen: MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MEMO1 Blocking Peptide, catalog no. 33R-1386, is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MEMO1

Target: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Alternative Name: MEMO1 (MEMO1 Products)

Synonyms: MGC89105 antibody, C2orf4 antibody, MEMO antibody, NS5ATP7 antibody, 0610016J10Rik antibody, D930048L02Rik antibody, RGD1309929 antibody, fi04d12 antibody, wu:fi04d12 antibody, zgc:55290 antibody, mediator of cell motility 1 antibody, mediator of cell motility 1 L homeolog antibody, MEMO1 antibody, memo1 antibody, Memo1 antibody, memo1.L antibody

Background: MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

Molecular Weight: 34 kDa (MW of target protein)