ACADVL antibody (N-Term)

Catalog No. ABIN630886

This Rabbit Polyclonal antibody specifically detects ACADVL in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for ACADVL antibody (N-Term) (ABIN630886)

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADVL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACADVL Antibody

Binding Specificity: N-Term

Specificity: ACADVL antibody was raised against the N terminal of ACADVL

Purification: Affinity purified

Immunogen: ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADVL Blocking Peptide, (ABIN5611880), is also available for use as a blocking control in assays to test for specificity of this ACADVL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADVL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Alternative Name: ACADVL

Background: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process