ACADS antibody (Middle Region)
-
- Target See all ACADS (Acads) Antibodies
- ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACADS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACADS antibody was raised against the middle region of ACADS
- Purification
- Affinity purified
- Immunogen
- ACADS antibody was raised using the middle region of ACADS corresponding to a region with amino acids FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA
- Top Product
- Discover our top product Acads Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACADS Blocking Peptide, catalog no. 33R-3100, is also available for use as a blocking control in assays to test for specificity of this ACADS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))
- Alternative Name
- ACADS (Acads Products)
- Background
- ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-