HSPB8 antibody (N-Term)

Catalog No. ABIN630901

This Rabbit Polyclonal antibody specifically detects HSPB8 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for HSPB8 antibody (N-Term) (ABIN630901)

Target: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPB8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSPB8 Antibody

Binding Specificity: N-Term

Specificity: HSPB8 antibody was raised against the N terminal of HSPB8

Purification: Affinity purified

Immunogen: HSPB8 antibody was raised using the N terminal of HSPB8 corresponding to a region with amino acids ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPB8 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HSPB8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPB8

Target: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Alternative Name: HSPB8

Background: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Molecular Weight: 21 kDa (MW of target protein)