GAMT antibody (Middle Region)

Catalog No. ABIN630904

Product Details anti-GAMT Antibody

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GAMT antibody was raised against the middle region of GAMT

Purification: Affinity purified

Immunogen: GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAMT Blocking Peptide, catalog no. 33R-7098, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAMT

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Alternative Name: GAMT (GAMT Products)

Synonyms: gamt antibody, zgc:123136 antibody, CCDS2 antibody, PIG2 antibody, TP53I2 antibody, AA571402 antibody, Spintz1 antibody, MGC75698 antibody, GAMT antibody, GMT antibody, guanidinoacetate N-methyltransferase L homeolog antibody, guanidinoacetate N-methyltransferase S homeolog antibody, guanidinoacetate N-methyltransferase antibody, guanidinoacetate methyltransferase antibody, gamt.L antibody, gamt.S antibody, gamt antibody, GAMT antibody, Gamt antibody

Background: GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia.

Molecular Weight: 29 kDa (MW of target protein)