SULT1B1 antibody (N-Term)

Catalog No. ABIN630908

The Rabbit Polyclonal anti-SULT1B1 antibody has been validated for WB. It is suitable to detect SULT1B1 in samples from Human and Dog.

Quick Overview for SULT1B1 antibody (N-Term) (ABIN630908)

Target: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SULT1B1 Antibody

Binding Specificity: N-Term

Specificity: SULT1 B1 antibody was raised against the N terminal of SULT1 1

Purification: Affinity purified

Immunogen: SULT1 B1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT1B1 Blocking Peptide, (ABIN940009), is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT1B1

Target: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Alternative Name: SULT1B1

Background: SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.

Molecular Weight: 35 kDa (MW of target protein)