GARS antibody (Middle Region)

Catalog No. ABIN630934

This Rabbit Polyclonal antibody specifically detects GARS in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GARS antibody (Middle Region) (ABIN630934)

Target: GARS (Glycyl-tRNA Synthetase (GARS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GARS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GARS Antibody

Binding Specificity: Middle Region

Specificity: GARS antibody was raised against the middle region of GARS

Purification: Affinity purified

Immunogen: GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GARS Blocking Peptide, (ABIN939335), is also available for use as a blocking control in assays to test for specificity of this GARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GARS

Target: GARS (Glycyl-tRNA Synthetase (GARS))

Alternative Name: GARS

Background: GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.

Molecular Weight: 83 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process