GARS antibody (Middle Region)

Catalog No. ABIN630934

Product Details anti-GARS Antibody

Target: GARS (Glycyl-tRNA Synthetase (GARS))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GARS antibody was raised against the middle region of GARS

Purification: Affinity purified

Immunogen: GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GARS

Target: GARS (Glycyl-tRNA Synthetase (GARS))

Alternative Name: GARS (GARS Products)

Background: GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.

Molecular Weight: 83 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process