PDE12 antibody (Middle Region)
-
- Target See all PDE12 Antibodies
- PDE12 (Phosphodiesterase 12 (PDE12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDE12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- 2'-PDE antibody was raised against the middle region of 2'-Pde
- Purification
- Affinity purified
- Immunogen
- 2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW
- Top Product
- Discover our top product PDE12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
2'-PDE Blocking Peptide, catalog no. 33R-1734, is also available for use as a blocking control in assays to test for specificity of this 2'-PDE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 2'-PDE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDE12 (Phosphodiesterase 12 (PDE12))
- Alternative Name
- 2'-PDE (PDE12 Products)
- Synonyms
- 2'-PDE antibody, E430028B21Rik antibody, LRRGT00074 antibody, RGD1310975 antibody, phosphodiesterase 12 S homeolog antibody, phosphodiesterase 12 antibody, pde12.S antibody, PDE12 antibody, pde12 antibody, Pde12 antibody
- Background
- 2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.
- Molecular Weight
- 67 kDa (MW of target protein)
-