LASP1 antibody (C-Term)

Catalog No. ABIN630939

This anti-LASP1 antibody is a Rabbit Polyclonal antibody detecting LASP1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for LASP1 antibody (C-Term) (ABIN630939)

Target: LASP1 (LIM and SH3 Protein 1 (LASP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LASP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LASP1 Antibody

Binding Specificity: C-Term

Specificity: LASP1 antibody was raised against the C terminal of LASP1

Purification: Affinity purified

Immunogen: LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LASP1 Blocking Peptide, (ABIN5614419), is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LASP1

Target: LASP1 (LIM and SH3 Protein 1 (LASP1))

Alternative Name: LASP1

Background: LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.

Molecular Weight: 30 kDa (MW of target protein)