LOC645015 (Middle Region) antibody

Catalog No. ABIN630945

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB. Suitable for Human.

Quick Overview for LOC645015 (Middle Region) antibody (ABIN630945)

Target: LOC645015

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: LOC645015 antibody was raised against the middle region of LOC645015

Purification: Affinity purified

Immunogen: LOC645015 antibody was raised using the middle region of LOC645015 corresponding to a region with amino acids LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC645015 Blocking Peptide, (ABIN5614525), is also available for use as a blocking control in assays to test for specificity of this LOC645015 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC645015 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: LOC645015

Background: The function of LOC645015 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 35 kDa (MW of target protein)