LYPLA1 antibody (Middle Region)

Catalog No. ABIN630946

This Rabbit Polyclonal antibody specifically detects LYPLA1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LYPLA1 antibody (Middle Region) (ABIN630946)

Target: LYPLA1 (Lysophospholipase I (LYPLA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPLA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LYPLA1 Antibody

Binding Specificity: Middle Region

Specificity: LYPLA1 antibody was raised against the middle region of LYPLA1

Purification: Affinity purified

Immunogen: LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPLA1 Blocking Peptide, (ABIN5614613), is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPLA1

Target: LYPLA1 (Lysophospholipase I (LYPLA1))

Alternative Name: LYPLA1

Background: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.

Molecular Weight: 25 kDa (MW of target protein)