LYPLA1 antibody (Middle Region)
-
- Target See all LYPLA1 Antibodies
- LYPLA1 (Lysophospholipase I (LYPLA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LYPLA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LYPLA1 antibody was raised against the middle region of LYPLA1
- Purification
- Affinity purified
- Immunogen
- LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
- Top Product
- Discover our top product LYPLA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LYPLA1 Blocking Peptide, catalog no. 33R-8940, is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LYPLA1 (Lysophospholipase I (LYPLA1))
- Alternative Name
- LYPLA1 (LYPLA1 Products)
- Synonyms
- APT-1 antibody, APT1 antibody, LPL-I antibody, LPL1 antibody, hAPT1 antibody, Pla1a antibody, 25KDL antibody, zgc:110260 antibody, lysophospholipase I antibody, lysophospholipase 1 antibody, lysophospholipase I L homeolog antibody, LYPLA1 antibody, Lypla1 antibody, lypla1 antibody, lypla1.L antibody
- Background
- Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.
- Molecular Weight
- 25 kDa (MW of target protein)
-